Lineage for d1zxca_ (1zxc A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2528985Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2528986Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 2529506Family d.92.1.10: TNF-alpha converting enzyme, TACE, catalytic domain [55525] (2 proteins)
    automatically mapped to Pfam PF13574
    automatically mapped to Pfam PF13583
  6. 2529507Protein TNF-alpha converting enzyme, TACE, catalytic domain [55526] (1 species)
  7. 2529508Species Human (Homo sapiens) [TaxId:9606] [55527] (20 PDB entries)
  8. 2529542Domain d1zxca_: 1zxc A: [125769]
    automated match to d1bkce_
    complexed with ih6, zn

Details for d1zxca_

PDB Entry: 1zxc (more details), 2.28 Å

PDB Description: Crystal structure of catalytic domain of TNF-alpha converting enzyme (TACE) with inhibitor
PDB Compounds: (A:) adam 17

SCOPe Domain Sequences for d1zxca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zxca_ d.92.1.10 (A:) TNF-alpha converting enzyme, TACE, catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
dpdpmkntckllvvadhrfyrymgrgeestttnylielidrvddiyrntawdnagfkgyg
iqieqirilkspqevkpgekhynmaksypneekdawdvkmlleqfsfdiaeeaskvclah
lftyqdfdmgtlglayvgspranshggvcpkayyspvgkkniylnsgltstknygktilt
keadlvtthelghnfgaehdpdglaecapnedqggkyvmypiavsgdhennkmfsqcskq
siyktieskaqecfqersn

SCOPe Domain Coordinates for d1zxca_:

Click to download the PDB-style file with coordinates for d1zxca_.
(The format of our PDB-style files is described here.)

Timeline for d1zxca_: