PDB entry 1zxc

View 1zxc on RCSB PDB site
Description: Crystal structure of catalytic domain of TNF-alpha converting enzyme (TACE) with inhibitor
Class: hydrolase
Keywords: TACE/ADAM-17, TACE-Inhibitor complex, Zn-endopeptidase, HYDROLASE
Deposited on 2005-06-07, released 2005-09-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.28 Å
R-factor: 0.216
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: adam 17
    Species: Homo sapiens [TaxId:9606]
    Gene: ADAM17, CSVP, TACE
    Database cross-references and differences (RAF-indexed):
    • Uniprot P78536
      • engineered (51)
      • engineered (237)
    Domains in SCOPe 2.08: d1zxca_
  • Chain 'B':
    Compound: adam 17
    Species: Homo sapiens [TaxId:9606]
    Gene: ADAM17, CSVP, TACE
    Database cross-references and differences (RAF-indexed):
    • Uniprot P78536
      • engineered (51)
      • engineered (237)
    Domains in SCOPe 2.08: d1zxcb_
  • Heterogens: ZN, IH6, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1zxcA (A:)
    radpdpmkntckllvvadhrfyrymgrgeestttnylielidrvddiyrntawdnagfkg
    ygiqieqirilkspqevkpgekhynmaksypneekdawdvkmlleqfsfdiaeeaskvcl
    ahlftyqdfdmgtlglayvgspranshggvcpkayyspvgkkniylnsgltstknygkti
    ltkeadlvtthelghnfgaehdpdglaecapnedqggkyvmypiavsgdhennkmfsqcs
    kqsiyktieskaqecfqersnkv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zxcA (A:)
    dpdpmkntckllvvadhrfyrymgrgeestttnylielidrvddiyrntawdnagfkgyg
    iqieqirilkspqevkpgekhynmaksypneekdawdvkmlleqfsfdiaeeaskvclah
    lftyqdfdmgtlglayvgspranshggvcpkayyspvgkkniylnsgltstknygktilt
    keadlvtthelghnfgaehdpdglaecapnedqggkyvmypiavsgdhennkmfsqcskq
    siyktieskaqecfqersn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1zxcB (B:)
    radpdpmkntckllvvadhrfyrymgrgeestttnylielidrvddiyrntawdnagfkg
    ygiqieqirilkspqevkpgekhynmaksypneekdawdvkmlleqfsfdiaeeaskvcl
    ahlftyqdfdmgtlglayvgspranshggvcpkayyspvgkkniylnsgltstknygkti
    ltkeadlvtthelghnfgaehdpdglaecapnedqggkyvmypiavsgdhennkmfsqcs
    kqsiyktieskaqecfqersnkv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zxcB (B:)
    pdpmkntckllvvadhrfyrymgrgeestttnylielidrvddiyrntawdnagfkgygi
    qieqirilkspqevkpgekhynmaksypneekdawdvkmlleqfsfdiaeeaskvclahl
    ftyqdfdmgtlglayvgspranshggvcpkayyspvgkkniylnsgltstknygktiltk
    eadlvtthelghnfgaehdpdglaecapnedqggkyvmypiavsgdhennkmfsqcskqs
    iyktieskaqecfqersn