SCOPe 2.01: Domain d1zwla_: 1zwl A:

Lineage for d1zwla_ (1zwl A:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.5: Flavoproteins [52218] (9 families)

5. Family c.23.5.8: WrbA-like [117474] (3 proteins)

6. Protein Trp repressor binding protein WrbA [117475] (3 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [142053] (3 PDB entries)
   Uniprot Q9I509 3-198! Uniprot Q9I509 4-196

8. Domain d1zwla_: 1zwl A: [125747]
   automated match to d2a5la1
   complexed with fmn

Details for d1zwla_

PDB Entry: 1zwl, 2.8 Å

PDB Description: structure of wrba from pseudomonas aeruginosa in complex with fmn

PDB Compounds: (A:) Trp repressor binding protein WrbA

SCOPe Domain Sequences for d1zwla_:

Sequence, based on SEQRES records:

>d1zwla_ c.23.5.8 (A:) Trp repressor binding protein WrbA {Pseudomonas aeruginosa [TaxId: 287]}
pyilvlyysrhgataemarqiargveqggfearvrtvpavsteceavapdipaegalyat
ledlkncaglalgsptrfgnmasplkyfldgtsslwltgslvgkpaavftstaslhggqe
ttqlsmllpllhhgmlvlgipysepalletrgggtpygashfagadgkrsldeheltlcr
algkrlaetagkle

Sequence, based on observed residues (ATOM records):

>d1zwla_ c.23.5.8 (A:) Trp repressor binding protein WrbA {Pseudomonas aeruginosa [TaxId: 287]}
pyilvlyysrhgataemarqiargveqggfearvrtvpavstgalyatledlkncaglal
gsptrfgnmasplkyfldgtsslwltgslvgkpaavftstaslhggqettqlsmllpllh
hgmlvlgipyggtpygashfagadgkrsldeheltlcralgkrlaetagkle

Timeline for d1zwla_:

• d1zwla_ first appeared in SCOP 1.73, called d1zwla1
  
• d1zwla_ was called d1zwla1 in SCOP 1.75
  
• d1zwla_ appears in SCOPe 2.02
  
• d1zwla_ appears in the current release, SCOPe 2.08, called d1zwla2