Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.5: Flavoproteins [52218] (9 families) |
Family c.23.5.8: WrbA-like [117474] (3 proteins) |
Protein Trp repressor binding protein WrbA [117475] (3 species) |
Species Pseudomonas aeruginosa [TaxId:287] [142053] (3 PDB entries) Uniprot Q9I509 3-198! Uniprot Q9I509 4-196 |
Domain d2a5la1: 2a5l A:3-198 [126176] Other proteins in same PDB: d2a5lb_ complexed with mg |
PDB Entry: 2a5l (more details), 1.7 Å
SCOPe Domain Sequences for d2a5la1:
Sequence, based on SEQRES records: (download)
>d2a5la1 c.23.5.8 (A:3-198) Trp repressor binding protein WrbA {Pseudomonas aeruginosa [TaxId: 287]} spyilvlyysrhgataemarqiargveqggfearvrtvpavsteceavapdipaegalya tledlkncaglalgsptrfgnmasplkyfldgtsslwltgslvgkpaavftstaslhggq ettqlsmllpllhhgmlvlgipysepalletrgggtpygashfagadgkrsldeheltlc ralgkrlaetagklgs
>d2a5la1 c.23.5.8 (A:3-198) Trp repressor binding protein WrbA {Pseudomonas aeruginosa [TaxId: 287]} spyilvlyysrhgataemarqiargveqggfearvrtvpavstalyatledlkncaglal gsptrfgnmasplkyfldgtsslwltgslvgkpaavftstaslhggqettqlsmllpllh hgmlvlgipytpygashfagadgkrsldeheltlcralgkrlaetagklgs
Timeline for d2a5la1: