SCOPe 2.08: Domain d1zwic2: 1zwi C:22-123

Lineage for d1zwic2 (1zwi C:22-123)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.14: Gated ion channels [81325] (2 superfamilies)
   oligomeric transmembrane alpha-helical proteins

4. Superfamily f.14.1: Voltage-gated ion channels [81324] (5 families)
   Pfam PF00520

5. Family f.14.1.1: Voltage-gated potassium channels [81323] (6 proteins)

6. Protein Potassium channel protein [56901] (3 species)

7. Species Streptomyces lividans [TaxId:1916] [161074] (36 PDB entries)

8. Domain d1zwic2: 1zwi C:22-123 [125740]
   Other proteins in same PDB: d1zwia1, d1zwia2, d1zwia3, d1zwib1, d1zwib2, d1zwic3
   automated match to d1k4cc_
   complexed with dga, f09, k; mutant

Details for d1zwic2

PDB Entry: 1zwi, 2.5 Å

PDB Description: structure of mutant kcsa potassium channel

PDB Compounds: (C:) Voltage-gated potassium channel

SCOPe Domain Sequences for d1zwic2:

Sequence; same for both SEQRES and ATOM records:

>d1zwic2 f.14.1.1 (C:22-123) Potassium channel protein {Streptomyces lividans [TaxId: 1916]}
salhwraagaatvllvivllagsylavlaergapgaqlitypralwwsvatattvgygdl
ypvtlwgrcvavvvmvagitsfglvtaalatwfvgreqerrg

Timeline for d1zwic2:

• d1zwic2 first appeared in SCOP 1.73, called d1zwic1
  
• d1zwic2 appears in SCOPe 2.07