PDB entry 1zwi

View 1zwi on RCSB PDB site
Description: Structure of mutant KcsA potassium channel
Class: immune system/ion transport
Keywords: x-ray crystallography; potassium ion channel; Transmembrane protein, IMMUNE SYSTEM-ION TRANSPORT COMPLEX
Deposited on 2005-06-03, released 2006-03-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.243
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: monoclonal antibody, heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1ZWI (0-218)
    Domains in SCOPe 2.07: d1zwia1, d1zwia2, d1zwia3
  • Chain 'B':
    Compound: monoclonal antibody light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1ZWI (0-211)
    Domains in SCOPe 2.07: d1zwib1, d1zwib2
  • Chain 'C':
    Compound: Voltage-gated potassium channel
    Species: Streptomyces lividans [TaxId:1916]
    Gene: kcsA, skc1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A334 (0-101)
      • engineered (49)
      • engineered (68)
      • cloning artifact (102)
    Domains in SCOPe 2.07: d1zwic2, d1zwic3
  • Heterogens: K, DGA, F09, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zwiA (A:)
    qvqlqqpgaelvkpgasvklsckasgytftsdwihwvkqrpghglewigeiipsygrany
    nekiqkkatltadkssstafmqlssltsedsavyycarergdgyfavwgagttvtvssak
    ttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdly
    tlsssvtvpssswpsetvtcnvahpasstkvdkkivprd
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zwiB (B:)
    dilltqspailsvspgervsfscrasqsigtdihwyqqrtngsprllikyasesisgips
    rfsgsgsgtdftlsinsvesedianyycqqsnrwpftfgsgtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrn
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1zwiC (C:)
    salhwraagaatvllvivllagsylavlaergapgaqlitypralwwsvatattvgygdl
    ypvtlwgrcvavvvmvagitsfglvtaalatwfvgreqerrga