Lineage for d1zujc_ (1zuj C:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2700837Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2700838Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2700839Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 2701715Protein Dodecameric ferritin homolog [47250] (16 species)
  7. 2701915Species Lactococcus lactis, DpsA [TaxId:1358] [140434] (1 PDB entry)
    Uniprot A2RLG8 6-173
  8. 2701918Domain d1zujc_: 1zuj C: [125674]
    automated match to d1zuja1

Details for d1zujc_

PDB Entry: 1zuj (more details), 2.9 Å

PDB Description: The crystal structure of the Lactococcus lactis MG1363 DpsA protein
PDB Compounds: (C:) hypothetical protein Llacc01001955

SCOPe Domain Sequences for d1zujc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zujc_ a.25.1.1 (C:) Dodecameric ferritin homolog {Lactococcus lactis, DpsA [TaxId: 1358]}
sidekyeaevkkseidhhkptagamlshvlsnifyekislmqaglyaksanyrikfreia
lkedewfyliseqlldenelvpttldefvsnhkfiendpkakywtdealienfindfqnq
nlfigraiklaqkeekfslelairklygynlsiipyfagelgktigef

SCOPe Domain Coordinates for d1zujc_:

Click to download the PDB-style file with coordinates for d1zujc_.
(The format of our PDB-style files is described here.)

Timeline for d1zujc_: