Lineage for d1zs6d_ (1zs6 D:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1906287Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1907823Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) (S)
  5. 1907824Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins)
  6. 1907825Protein Nucleoside diphosphate kinase, NDK [54921] (23 species)
  7. 1907911Species Human (Homo sapiens), NDK3 [TaxId:9606] [143283] (1 PDB entry)
    Uniprot Q13232 18-169
  8. 1907914Domain d1zs6d_: 1zs6 D: [125592]
    automated match to d1zs6a1
    complexed with adp

Details for d1zs6d_

PDB Entry: 1zs6 (more details), 2.3 Å

PDB Description: structure of human nucleoside-diphosphate kinase 3
PDB Compounds: (D:) Nucleoside diphosphate kinase 3

SCOPe Domain Sequences for d1zs6d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zs6d_ d.58.6.1 (D:) Nucleoside diphosphate kinase, NDK {Human (Homo sapiens), NDK3 [TaxId: 9606]}
tgahertflavkpdgvqrrlvgeivrrferkgfklvalklvqaseellrehyaelrerpf
ygrlvkymasgpvvamvwqgldvvrtsraligatnpadappgtirgdfcievgknlihgs
dsvesarreialwfradellcwedsaghwlye

SCOPe Domain Coordinates for d1zs6d_:

Click to download the PDB-style file with coordinates for d1zs6d_.
(The format of our PDB-style files is described here.)

Timeline for d1zs6d_: