Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) |
Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins) |
Protein Nucleoside diphosphate kinase, NDK [54921] (23 species) |
Species Human (Homo sapiens), NDK3 [TaxId:9606] [143283] (1 PDB entry) Uniprot Q13232 18-169 |
Domain d1zs6d_: 1zs6 D: [125592] automated match to d1zs6a1 complexed with adp |
PDB Entry: 1zs6 (more details), 2.3 Å
SCOPe Domain Sequences for d1zs6d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zs6d_ d.58.6.1 (D:) Nucleoside diphosphate kinase, NDK {Human (Homo sapiens), NDK3 [TaxId: 9606]} tgahertflavkpdgvqrrlvgeivrrferkgfklvalklvqaseellrehyaelrerpf ygrlvkymasgpvvamvwqgldvvrtsraligatnpadappgtirgdfcievgknlihgs dsvesarreialwfradellcwedsaghwlye
Timeline for d1zs6d_: