Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.58: Ferredoxin-like [54861] (55 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (1 family) |
Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (1 protein) |
Protein Nucleoside diphosphate kinase, NDK [54921] (20 species) |
Species Human(Homo sapiens), NDK3 [TaxId:9606] [143283] (1 PDB entry) |
Domain d1zs6d1: 1zs6 D:18-169 [125592] automatically matched to 1ZS6 A:18-169 complexed with adp |
PDB Entry: 1zs6 (more details), 2.3 Å
SCOP Domain Sequences for d1zs6d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zs6d1 d.58.6.1 (D:18-169) Nucleoside diphosphate kinase, NDK {Human(Homo sapiens), NDK3 [TaxId: 9606]} tgahertflavkpdgvqrrlvgeivrrferkgfklvalklvqaseellrehyaelrerpf ygrlvkymasgpvvamvwqgldvvrtsraligatnpadappgtirgdfcievgknlihgs dsvesarreialwfradellcwedsaghwlye
Timeline for d1zs6d1: