Lineage for d1zs6d1 (1zs6 D:18-169)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 723373Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 724082Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (1 family) (S)
  5. 724083Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (1 protein)
  6. 724084Protein Nucleoside diphosphate kinase, NDK [54921] (20 species)
  7. 724219Species Human(Homo sapiens), NDK3 [TaxId:9606] [143283] (1 PDB entry)
  8. 724222Domain d1zs6d1: 1zs6 D:18-169 [125592]
    automatically matched to 1ZS6 A:18-169
    complexed with adp

Details for d1zs6d1

PDB Entry: 1zs6 (more details), 2.3 Å

PDB Description: structure of human nucleoside-diphosphate kinase 3
PDB Compounds: (D:) Nucleoside diphosphate kinase 3

SCOP Domain Sequences for d1zs6d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zs6d1 d.58.6.1 (D:18-169) Nucleoside diphosphate kinase, NDK {Human(Homo sapiens), NDK3 [TaxId: 9606]}
tgahertflavkpdgvqrrlvgeivrrferkgfklvalklvqaseellrehyaelrerpf
ygrlvkymasgpvvamvwqgldvvrtsraligatnpadappgtirgdfcievgknlihgs
dsvesarreialwfradellcwedsaghwlye

SCOP Domain Coordinates for d1zs6d1:

Click to download the PDB-style file with coordinates for d1zs6d1.
(The format of our PDB-style files is described here.)

Timeline for d1zs6d1: