SCOP 1.75: Domain d1zs6b1: 1zs6 B:18-169

Lineage for d1zs6b1 (1zs6 B:18-169)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (1 family)

5. Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (1 protein)

6. Protein Nucleoside diphosphate kinase, NDK [54921] (20 species)

7. Species Human(Homo sapiens), NDK3 [TaxId:9606] [143283] (1 PDB entry)
   Uniprot Q13232 18-169

8. Domain d1zs6b1: 1zs6 B:18-169 [125591]
   automatically matched to 1ZS6 A:18-169
   complexed with adp

Details for d1zs6b1

PDB Entry: 1zs6, 2.3 Å

PDB Description: structure of human nucleoside-diphosphate kinase 3

PDB Compounds: (B:) Nucleoside diphosphate kinase 3

SCOP Domain Sequences for d1zs6b1:

Sequence; same for both SEQRES and ATOM records:

>d1zs6b1 d.58.6.1 (B:18-169) Nucleoside diphosphate kinase, NDK {Human(Homo sapiens), NDK3 [TaxId: 9606]}
tgahertflavkpdgvqrrlvgeivrrferkgfklvalklvqaseellrehyaelrerpf
ygrlvkymasgpvvamvwqgldvvrtsraligatnpadappgtirgdfcievgknlihgs
dsvesarreialwfradellcwedsaghwlye

Timeline for d1zs6b1:

• d1zs6b1 first appeared in SCOP 1.73
  
• d1zs6b1 is called d1zs6b_ in SCOPe 2.01
  
• d1zs6b1 appears in the current release, SCOPe 2.08, called d1zs6b_