Lineage for d1zs6b_ (1zs6 B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2951070Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) (S)
  5. 2951071Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins)
  6. 2951072Protein Nucleoside diphosphate kinase, NDK [54921] (23 species)
  7. 2951158Species Human (Homo sapiens), NDK3 [TaxId:9606] [143283] (1 PDB entry)
    Uniprot Q13232 18-169
  8. 2951160Domain d1zs6b_: 1zs6 B: [125591]
    automated match to d1zs6a1
    complexed with adp

Details for d1zs6b_

PDB Entry: 1zs6 (more details), 2.3 Å

PDB Description: structure of human nucleoside-diphosphate kinase 3
PDB Compounds: (B:) Nucleoside diphosphate kinase 3

SCOPe Domain Sequences for d1zs6b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zs6b_ d.58.6.1 (B:) Nucleoside diphosphate kinase, NDK {Human (Homo sapiens), NDK3 [TaxId: 9606]}
tgahertflavkpdgvqrrlvgeivrrferkgfklvalklvqaseellrehyaelrerpf
ygrlvkymasgpvvamvwqgldvvrtsraligatnpadappgtirgdfcievgknlihgs
dsvesarreialwfradellcwedsaghwlye

SCOPe Domain Coordinates for d1zs6b_:

Click to download the PDB-style file with coordinates for d1zs6b_.
(The format of our PDB-style files is described here.)

Timeline for d1zs6b_: