Lineage for d1zruc1 (1zru C:162-264)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1117302Fold b.21: Virus attachment protein globular domain [49834] (1 superfamily)
    sandwich, 10 strands in 2 sheets; greek-key
  4. 1117303Superfamily b.21.1: Virus attachment protein globular domain [49835] (4 families) (S)
  5. 1117410Family b.21.1.3: Lactophage receptor-binding protein head domain [141122] (2 proteins)
  6. 1117416Protein receptor binding protein, rbp, C-terminal domain [141125] (1 species)
  7. 1117417Species Lactococcus lactis phage p2 [TaxId:100641] [141126] (2 PDB entries)
    Uniprot Q71AW2 162-264
  8. 1117420Domain d1zruc1: 1zru C:162-264 [125566]
    Other proteins in same PDB: d1zrua2, d1zrua3, d1zrub2, d1zrub3, d1zruc2, d1zruc3
    automatically matched to 1ZRU A:162-264
    complexed with gol

Details for d1zruc1

PDB Entry: 1zru (more details), 1.73 Å

PDB Description: structure of the lactophage p2 receptor binding protein in complex with glycerol
PDB Compounds: (C:) lactophage p2 receptor binding protein

SCOPe Domain Sequences for d1zruc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zruc1 b.21.1.3 (C:162-264) receptor binding protein, rbp, C-terminal domain {Lactococcus lactis phage p2 [TaxId: 100641]}
pvqtltveagnglqlqltkknndlvivrffgsvsniqkgwnmsgtwvdrpfrpaavqslv
ghfagrdtsfhidinpngsitwwganidktpiatrgngsyfik

SCOPe Domain Coordinates for d1zruc1:

Click to download the PDB-style file with coordinates for d1zruc1.
(The format of our PDB-style files is described here.)

Timeline for d1zruc1: