SCOPe 2.01: Domain d1zruc1: 1zru C:162-264

Lineage for d1zruc1 (1zru C:162-264)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.21: Virus attachment protein globular domain [49834] (1 superfamily)
   sandwich, 10 strands in 2 sheets; greek-key

4. Superfamily b.21.1: Virus attachment protein globular domain [49835] (4 families)

5. Family b.21.1.3: Lactophage receptor-binding protein head domain [141122] (2 proteins)

6. Protein receptor binding protein, rbp, C-terminal domain [141125] (1 species)

7. Species Lactococcus lactis phage p2 [TaxId:100641] [141126] (2 PDB entries)
   Uniprot Q71AW2 162-264

8. Domain d1zruc1: 1zru C:162-264 [125566]
   Other proteins in same PDB: d1zrua2, d1zrua3, d1zrub2, d1zrub3, d1zruc2, d1zruc3
   automatically matched to 1ZRU A:162-264
   complexed with gol

Details for d1zruc1

PDB Entry: 1zru, 1.73 Å

PDB Description: structure of the lactophage p2 receptor binding protein in complex with glycerol

PDB Compounds: (C:) lactophage p2 receptor binding protein

SCOPe Domain Sequences for d1zruc1:

Sequence; same for both SEQRES and ATOM records:

>d1zruc1 b.21.1.3 (C:162-264) receptor binding protein, rbp, C-terminal domain {Lactococcus lactis phage p2 [TaxId: 100641]}
pvqtltveagnglqlqltkknndlvivrffgsvsniqkgwnmsgtwvdrpfrpaavqslv
ghfagrdtsfhidinpngsitwwganidktpiatrgngsyfik

Timeline for d1zruc1:

• d1zruc1 first appeared in SCOP 1.73
  
• d1zruc1 appears in SCOP 1.75
  
• d1zruc1 appears in SCOPe 2.02
  
• d1zruc1 appears in the current release, SCOPe 2.08