Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies) 3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest |
Superfamily c.51.4: ITPase-like [52972] (4 families) formerly Maf/Ham1; elaborated with additional structures inserted in the common fold |
Family c.51.4.0: automated matches [191335] (1 protein) not a true family |
Protein automated matches [190179] (9 species) not a true protein |
Species Vibrio cholerae [TaxId:666] [186916] (2 PDB entries) |
Domain d1znob_: 1zno B: [125393] automated match to d1u14a_ complexed with mg |
PDB Entry: 1zno (more details), 2 Å
SCOPe Domain Sequences for d1znob_:
Sequence, based on SEQRES records: (download)
>d1znob_ c.51.4.0 (B:) automated matches {Vibrio cholerae [TaxId: 666]} mrkiiiasqnpakvnavrsafstvfpdqewefigvsvpsevadqpmsdeetkqgalnrvr nakqrhpgaeyyvgleagieenktfawmivesdqqrgesrsaclmlpplvlerlrqakel gdvmdevfgtenikqkggaiglltrhhltrstvyhqalilalipfinpehyps
>d1znob_ c.51.4.0 (B:) automated matches {Vibrio cholerae [TaxId: 666]} mrkiiiasqnpakvnavrsafstvfpdqewefigvsvpsevadqpmsdeetkqgalnrvr nakqrhpgaeyyvgleagieenktfawmivesdqqrgesrsaclmlpplvlerlrqakgd vmdeikqkggaiglltrhhltrstvyhqalilalipfinpehyps
Timeline for d1znob_: