SCOPe 2.08: Domain d1znob_: 1zno B:

Lineage for d1znob_ (1zno B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest

4. Superfamily c.51.4: ITPase-like [52972] (4 families)
   formerly Maf/Ham1; elaborated with additional structures inserted in the common fold

5. Family c.51.4.0: automated matches [191335] (1 protein)
   not a true family

6. Protein automated matches [190179] (9 species)
   not a true protein

7. Species Vibrio cholerae [TaxId:666] [186916] (2 PDB entries)

8. Domain d1znob_: 1zno B: [125393]
   automated match to d1u14a_
   complexed with mg

Details for d1znob_

PDB Entry: 1zno, 2 Å

PDB Description: Crystal Structure of VC702 from Vibrio Cholerae, Northeast Structural Genomics Consortium Target: VcP1

PDB Compounds: (B:) Hypothetical UPF0244 protein VC0702

SCOPe Domain Sequences for d1znob_:

Sequence, based on SEQRES records:

>d1znob_ c.51.4.0 (B:) automated matches {Vibrio cholerae [TaxId: 666]}
mrkiiiasqnpakvnavrsafstvfpdqewefigvsvpsevadqpmsdeetkqgalnrvr
nakqrhpgaeyyvgleagieenktfawmivesdqqrgesrsaclmlpplvlerlrqakel
gdvmdevfgtenikqkggaiglltrhhltrstvyhqalilalipfinpehyps

Sequence, based on observed residues (ATOM records):

>d1znob_ c.51.4.0 (B:) automated matches {Vibrio cholerae [TaxId: 666]}
mrkiiiasqnpakvnavrsafstvfpdqewefigvsvpsevadqpmsdeetkqgalnrvr
nakqrhpgaeyyvgleagieenktfawmivesdqqrgesrsaclmlpplvlerlrqakgd
vmdeikqkggaiglltrhhltrstvyhqalilalipfinpehyps

Timeline for d1znob_:

• d1znob_ first appeared in SCOP 1.73, called d1znob1
  
• d1znob_ appears in SCOPe 2.07