Lineage for d1znob_ (1zno B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2881870Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest
  4. 2882121Superfamily c.51.4: ITPase-like [52972] (4 families) (S)
    formerly Maf/Ham1; elaborated with additional structures inserted in the common fold
  5. 2882183Family c.51.4.0: automated matches [191335] (1 protein)
    not a true family
  6. 2882184Protein automated matches [190179] (9 species)
    not a true protein
  7. 2882233Species Vibrio cholerae [TaxId:666] [186916] (2 PDB entries)
  8. 2882235Domain d1znob_: 1zno B: [125393]
    automated match to d1u14a_
    complexed with mg

Details for d1znob_

PDB Entry: 1zno (more details), 2 Å

PDB Description: Crystal Structure of VC702 from Vibrio Cholerae, Northeast Structural Genomics Consortium Target: VcP1
PDB Compounds: (B:) Hypothetical UPF0244 protein VC0702

SCOPe Domain Sequences for d1znob_:

Sequence, based on SEQRES records: (download)

>d1znob_ c.51.4.0 (B:) automated matches {Vibrio cholerae [TaxId: 666]}
mrkiiiasqnpakvnavrsafstvfpdqewefigvsvpsevadqpmsdeetkqgalnrvr
nakqrhpgaeyyvgleagieenktfawmivesdqqrgesrsaclmlpplvlerlrqakel
gdvmdevfgtenikqkggaiglltrhhltrstvyhqalilalipfinpehyps

Sequence, based on observed residues (ATOM records): (download)

>d1znob_ c.51.4.0 (B:) automated matches {Vibrio cholerae [TaxId: 666]}
mrkiiiasqnpakvnavrsafstvfpdqewefigvsvpsevadqpmsdeetkqgalnrvr
nakqrhpgaeyyvgleagieenktfawmivesdqqrgesrsaclmlpplvlerlrqakgd
vmdeikqkggaiglltrhhltrstvyhqalilalipfinpehyps

SCOPe Domain Coordinates for d1znob_:

Click to download the PDB-style file with coordinates for d1znob_.
(The format of our PDB-style files is described here.)

Timeline for d1znob_: