Lineage for d1zm9c3 (1zm9 C:561-725)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2930059Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 2930060Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 2930061Family d.14.1.1: Translational machinery components [54212] (5 proteins)
  6. 2930062Protein Elongation factor 2 (eEF-2), domain IV [82575] (2 species)
  7. 2930063Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82576] (13 PDB entries)
    Uniprot P32324
  8. 2930073Domain d1zm9c3: 1zm9 C:561-725 [125344]
    Other proteins in same PDB: d1zm9a1, d1zm9a2, d1zm9a4, d1zm9a5, d1zm9b_, d1zm9c1, d1zm9c2, d1zm9c4, d1zm9c5, d1zm9d_, d1zm9e1, d1zm9e2, d1zm9e4, d1zm9e5, d1zm9f_
    automated match to d1n0vc3
    complexed with p34
    has additional insertions and/or extensions that are not grouped together

Details for d1zm9c3

PDB Entry: 1zm9 (more details), 2.8 Å

PDB Description: Structure of eEF2-ETA in complex with PJ34
PDB Compounds: (C:) Elongation factor 2

SCOPe Domain Sequences for d1zm9c3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zm9c3 d.14.1.1 (C:561-725) Elongation factor 2 (eEF-2), domain IV {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
vayretvesessqtalskspnkhnriylkaepideevslaiengiinprddfkararima
ddygwdvtdarkiwcfgpdgngpnlvidqtkavqylheikdsvvaafqwatkegpifgee
mrsvrvnildvtlhadaihrgggqiiptmrratyagflladpkiq

SCOPe Domain Coordinates for d1zm9c3:

Click to download the PDB-style file with coordinates for d1zm9c3.
(The format of our PDB-style files is described here.)

Timeline for d1zm9c3: