Lineage for d1zm9e2 (1zm9 E:2-343)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2110099Family c.37.1.8: G proteins [52592] (79 protein domains)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2110387Protein Elongation factor 2 (eEF-2), N-terminal (G) domain [82404] (2 species)
  7. 2110388Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82405] (13 PDB entries)
    Uniprot P32324
  8. 2110406Domain d1zm9e2: 1zm9 E:2-343 [125349]
    Other proteins in same PDB: d1zm9a1, d1zm9a3, d1zm9a4, d1zm9a5, d1zm9b_, d1zm9c1, d1zm9c3, d1zm9c4, d1zm9c5, d1zm9d_, d1zm9e1, d1zm9e3, d1zm9e4, d1zm9e5, d1zm9f_
    automated match to d1n0vc2
    complexed with p34

Details for d1zm9e2

PDB Entry: 1zm9 (more details), 2.8 Å

PDB Description: Structure of eEF2-ETA in complex with PJ34
PDB Compounds: (E:) Elongation factor 2

SCOPe Domain Sequences for d1zm9e2:

Sequence, based on SEQRES records: (download)

>d1zm9e2 c.37.1.8 (E:2-343) Elongation factor 2 (eEF-2), N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
vaftvdqmrslmdkvtnvrnmsviahvdhgkstltdslvqragiisaakagearftdtrk
deqergitikstaislysemsdedvkeikqktdgnsflinlidspghvdfssevtaalrv
tdgalvvvdtiegvcvqtetvlrqalgerikpvvvinkvdrallelqvskedlyqtfart
vesvnvivstyadevlgdvqvypargtvafgsglhgwaftirqfatryakkfgvdkakmm
drlwgdsffnpktkkwtnkdtdaegkplerafnmfildpifrlftaimnfkkdeipvlle
kleivlkgdekdlegkallkvvmrkflpaadallemivlhlp

Sequence, based on observed residues (ATOM records): (download)

>d1zm9e2 c.37.1.8 (E:2-343) Elongation factor 2 (eEF-2), N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
vaftvdqmrslmdkvtnvrnmsviahvdhgkstltdslvqragiisagitikstaislys
emsdedvkeikqktdgnsflinlidspghvdfssevtaalrvtdgalvvvdtiegvcvqt
etvlrqalgerikpvvvinkvdrallelqvskedlyqtfartvesvnvivstyadevlgd
vqvypargtvafgsglhgwaftirqfatryakkfgvdkakmmdrlwgdsffnpktkkwtn
kdtdaegkplerafnmfildpifrlftaimnfkkdeipvllekleivlkgdekdlegkal
lkvvmrkflpaadallemivlhlp

SCOPe Domain Coordinates for d1zm9e2:

Click to download the PDB-style file with coordinates for d1zm9e2.
(The format of our PDB-style files is described here.)

Timeline for d1zm9e2: