Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) division into families based on beta-sheet topologies |
Family c.37.1.8: G proteins [52592] (81 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
Protein Elongation factor 2 (eEF-2), N-terminal (G) domain [82404] (2 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82405] (13 PDB entries) Uniprot P32324 |
Domain d1zm9e2: 1zm9 E:2-343 [125349] Other proteins in same PDB: d1zm9a1, d1zm9a3, d1zm9a4, d1zm9a5, d1zm9b_, d1zm9c1, d1zm9c3, d1zm9c4, d1zm9c5, d1zm9d_, d1zm9e1, d1zm9e3, d1zm9e4, d1zm9e5, d1zm9f_ automated match to d1n0vc2 complexed with p34 has additional subdomain(s) that are not in the common domain |
PDB Entry: 1zm9 (more details), 2.8 Å
SCOPe Domain Sequences for d1zm9e2:
Sequence, based on SEQRES records: (download)
>d1zm9e2 c.37.1.8 (E:2-343) Elongation factor 2 (eEF-2), N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} vaftvdqmrslmdkvtnvrnmsviahvdhgkstltdslvqragiisaakagearftdtrk deqergitikstaislysemsdedvkeikqktdgnsflinlidspghvdfssevtaalrv tdgalvvvdtiegvcvqtetvlrqalgerikpvvvinkvdrallelqvskedlyqtfart vesvnvivstyadevlgdvqvypargtvafgsglhgwaftirqfatryakkfgvdkakmm drlwgdsffnpktkkwtnkdtdaegkplerafnmfildpifrlftaimnfkkdeipvlle kleivlkgdekdlegkallkvvmrkflpaadallemivlhlp
>d1zm9e2 c.37.1.8 (E:2-343) Elongation factor 2 (eEF-2), N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} vaftvdqmrslmdkvtnvrnmsviahvdhgkstltdslvqragiisagitikstaislys emsdedvkeikqktdgnsflinlidspghvdfssevtaalrvtdgalvvvdtiegvcvqt etvlrqalgerikpvvvinkvdrallelqvskedlyqtfartvesvnvivstyadevlgd vqvypargtvafgsglhgwaftirqfatryakkfgvdkakmmdrlwgdsffnpktkkwtn kdtdaegkplerafnmfildpifrlftaimnfkkdeipvllekleivlkgdekdlegkal lkvvmrkflpaadallemivlhlp
Timeline for d1zm9e2:
View in 3D Domains from same chain: (mouse over for more information) d1zm9e1, d1zm9e3, d1zm9e4, d1zm9e5 |