|  | Class d: Alpha and beta proteins (a+b) [53931] (380 folds) | 
|  | Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 | 
|  | Superfamily d.58.11: EF-G C-terminal domain-like [54980] (4 families)  | 
|  | Family d.58.11.1: EF-G/eEF-2 domains III and V [54981] (2 proteins) domain III structure is lacking some of the superfamily characters and is often disordered in crystals | 
|  | Protein Elongation factor 2 (eEF-2) [82677] (1 species) | 
|  | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82678] (13 PDB entries) Uniprot P32324 | 
|  | Domain d1zm9a5: 1zm9 A:726-842 [125340] Other proteins in same PDB: d1zm9a1, d1zm9a2, d1zm9a3, d1zm9b_, d1zm9c1, d1zm9c2, d1zm9c3, d1zm9d_, d1zm9e1, d1zm9e2, d1zm9e3, d1zm9f_ automated match to d1n0vc5 complexed with p34 | 
PDB Entry: 1zm9 (more details), 2.8 Å
SCOPe Domain Sequences for d1zm9a5:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zm9a5 d.58.11.1 (A:726-842) Elongation factor 2 (eEF-2) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
epvflveiqcpeqavggiysvlnkkrgqvvseeqrpgtplftvkaylpvnesfgftgelr
qatggqafpqmvfdhwstlgsdpldptskageivlaarkrhgmkeevpgwqeyydkl
Timeline for d1zm9a5:
|  View in 3D Domains from same chain: (mouse over for more information) d1zm9a1, d1zm9a2, d1zm9a3, d1zm9a4 |