Lineage for d1zm9f_ (1zm9 F:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1681419Fold d.166: ADP-ribosylation [56398] (1 superfamily)
    unusual fold
  4. 1681420Superfamily d.166.1: ADP-ribosylation [56399] (8 families) (S)
  5. 1681421Family d.166.1.1: ADP-ribosylating toxins [56400] (10 proteins)
  6. 1681563Protein automated matches [190133] (5 species)
    not a true protein
  7. 1681617Species Pseudomonas aeruginosa [TaxId:287] [186856] (4 PDB entries)
  8. 1681622Domain d1zm9f_: 1zm9 F: [125353]
    Other proteins in same PDB: d1zm9a1, d1zm9a2, d1zm9a3, d1zm9a4, d1zm9a5, d1zm9c1, d1zm9c2, d1zm9c3, d1zm9c4, d1zm9c5, d1zm9e1, d1zm9e2, d1zm9e3, d1zm9e4, d1zm9e5
    automated match to d1aera_
    complexed with p34

Details for d1zm9f_

PDB Entry: 1zm9 (more details), 2.8 Å

PDB Description: Structure of eEF2-ETA in complex with PJ34
PDB Compounds: (F:) exotoxin a

SCOPe Domain Sequences for d1zm9f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zm9f_ d.166.1.1 (F:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
eflgdggdvsfstrgtqnwtverllqahrqleergyvfvgyhgtfleaaqsivfggvrar
sqdldaiwrgfyiagdpalaygyaqdqepdargrirngallrvyvprsslpgfyrtsltl
aapeaageverlighplplrldaitgpeeeggrletilgwplaertvvipsaiptdprnv
ggdldpssipdkeqaisalpdyasqpg

SCOPe Domain Coordinates for d1zm9f_:

Click to download the PDB-style file with coordinates for d1zm9f_.
(The format of our PDB-style files is described here.)

Timeline for d1zm9f_: