|  | Class b: All beta proteins [48724] (174 folds) | 
|  | Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key | 
|  | Superfamily b.43.3: Translation proteins [50447] (7 families)  | 
|  | Family b.43.3.1: Elongation factors [50448] (10 proteins) | 
|  | Protein Elongation factor 2 (eEF-2), domain II [82118] (1 species) | 
|  | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82119] (16 PDB entries) Uniprot P32324 | 
|  | Domain d1zm4c1: 1zm4 C:344-481 [125322] Other proteins in same PDB: d1zm4a2, d1zm4a3, d1zm4a4, d1zm4a5, d1zm4b_, d1zm4c2, d1zm4c3, d1zm4c4, d1zm4c5, d1zm4d_, d1zm4e2, d1zm4e3, d1zm4e4, d1zm4e5, d1zm4f_ automated match to d1n0vc1 complexed with tad | 
PDB Entry: 1zm4 (more details), 2.9 Å
SCOPe Domain Sequences for d1zm4c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zm4c1 b.43.3.1 (C:344-481) Elongation factor 2 (eEF-2), domain II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
spvtaqayraeqlyegpaddanciaikncdpkadlmlyvskmvptsdkgrfyafgrvfag
tvksgqkvriqgpnyvpgkkddlfikaiqrvvlmmgrfvepiddcpagniiglvgidqfl
lktgtlttsetahnmkvm
Timeline for d1zm4c1:
|  View in 3D Domains from same chain: (mouse over for more information) d1zm4c2, d1zm4c3, d1zm4c4, d1zm4c5 |