| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily) core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover |
Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) ![]() |
| Family d.14.1.1: Translational machinery components [54212] (4 proteins) |
| Protein Elongation factor 2 (eEF-2), domain IV [82575] (1 species) |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82576] (16 PDB entries) Uniprot P32324 |
| Domain d1zm4e3: 1zm4 E:561-725 [125330] Other proteins in same PDB: d1zm4a1, d1zm4a2, d1zm4a4, d1zm4a5, d1zm4b_, d1zm4c1, d1zm4c2, d1zm4c4, d1zm4c5, d1zm4d_, d1zm4e1, d1zm4e2, d1zm4e4, d1zm4e5, d1zm4f_ automated match to d1n0vc3 complexed with tad |
PDB Entry: 1zm4 (more details), 2.9 Å
SCOPe Domain Sequences for d1zm4e3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zm4e3 d.14.1.1 (E:561-725) Elongation factor 2 (eEF-2), domain IV {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
vayretvesessqtalskspnkhnriylkaepideevslaiengiinprddfkararima
ddygwdvtdarkiwcfgpdgngpnlvidqtkavqylheikdsvvaafqwatkegpifgee
mrsvrvnildvtlhadaihrgggqiiptmrratyagflladpkiq
Timeline for d1zm4e3:
View in 3DDomains from same chain: (mouse over for more information) d1zm4e1, d1zm4e2, d1zm4e4, d1zm4e5 |