Lineage for d1zm4c1 (1zm4 C:344-481)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2792909Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2792984Superfamily b.43.3: Translation proteins [50447] (7 families) (S)
  5. 2792985Family b.43.3.1: Elongation factors [50448] (11 proteins)
  6. 2792986Protein Elongation factor 2 (eEF-2), domain II [82118] (2 species)
  7. 2792987Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82119] (13 PDB entries)
    Uniprot P32324
  8. 2793003Domain d1zm4c1: 1zm4 C:344-481 [125322]
    Other proteins in same PDB: d1zm4a2, d1zm4a3, d1zm4a4, d1zm4a5, d1zm4b_, d1zm4c2, d1zm4c3, d1zm4c4, d1zm4c5, d1zm4d_, d1zm4e2, d1zm4e3, d1zm4e4, d1zm4e5, d1zm4f_
    automated match to d1n0vc1
    complexed with tad

Details for d1zm4c1

PDB Entry: 1zm4 (more details), 2.9 Å

PDB Description: Structure of the eEF2-ETA-bTAD complex
PDB Compounds: (C:) Elongation factor 2

SCOPe Domain Sequences for d1zm4c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zm4c1 b.43.3.1 (C:344-481) Elongation factor 2 (eEF-2), domain II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
spvtaqayraeqlyegpaddanciaikncdpkadlmlyvskmvptsdkgrfyafgrvfag
tvksgqkvriqgpnyvpgkkddlfikaiqrvvlmmgrfvepiddcpagniiglvgidqfl
lktgtlttsetahnmkvm

SCOPe Domain Coordinates for d1zm4c1:

Click to download the PDB-style file with coordinates for d1zm4c1.
(The format of our PDB-style files is described here.)

Timeline for d1zm4c1: