Lineage for d1zm3c3 (1zm3 C:561-725)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1636635Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 1636636Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 1637334Family d.14.1.0: automated matches [191504] (1 protein)
    not a true family
  6. 1637335Protein automated matches [190826] (16 species)
    not a true protein
  7. 1637370Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [255013] (5 PDB entries)
  8. 1637380Domain d1zm3c3: 1zm3 C:561-725 [125306]
    Other proteins in same PDB: d1zm3a1, d1zm3a2, d1zm3a4, d1zm3a5, d1zm3b_, d1zm3c1, d1zm3c2, d1zm3c4, d1zm3c5, d1zm3d_, d1zm3e1, d1zm3e2, d1zm3e4, d1zm3e5, d1zm3f_
    automated match to d1n0ua3

Details for d1zm3c3

PDB Entry: 1zm3 (more details), 3.07 Å

PDB Description: Structure of the apo eEF2-ETA complex
PDB Compounds: (C:) Elongation factor 2

SCOPe Domain Sequences for d1zm3c3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zm3c3 d.14.1.0 (C:561-725) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
vayretvesessqtalskspnkhnriylkaepideevslaiengiinprddfkararima
ddygwdvtdarkiwcfgpdgngpnlvidqtkavqylheikdsvvaafqwatkegpifgee
mrsvrvnildvtlhadaihrgggqiiptmrratyagflladpkiq

SCOPe Domain Coordinates for d1zm3c3:

Click to download the PDB-style file with coordinates for d1zm3c3.
(The format of our PDB-style files is described here.)

Timeline for d1zm3c3: