SCOPe 2.03: Domain d1zlag_: 1zla G:

Lineage for d1zlag_ (1zla G:)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.22: Histone-fold [47112] (1 superfamily)
   core: 3 helices; long middle helix is flanked at each end with shorter ones

4. Superfamily a.22.1: Histone-fold [47113] (5 families)

5. Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
   form octamers composed of two copies of each of the four histones

6. Protein Histone H2A [47115] (6 species)

7. Species African clawed frog (Xenopus laevis) [TaxId:8355] [47117] (34 PDB entries)

8. Domain d1zlag_: 1zla G: [125246]
   Other proteins in same PDB: d1zlaa_, d1zlab_, d1zlad_, d1zlae_, d1zlaf_, d1zlah_
   automated match to d1kx5c_
   protein/DNA complex

Details for d1zlag_

PDB Entry: 1zla, 2.9 Å

PDB Description: x-ray structure of a kaposi's sarcoma herpesvirus lana peptide bound to the nucleosomal core

PDB Compounds: (G:) Xenopus laevis-like histone H2A

SCOPe Domain Sequences for d1zlag_:

Sequence; same for both SEQRES and ATOM records:

>d1zlag_ a.22.1.1 (G:) Histone H2A {African clawed frog (Xenopus laevis) [TaxId: 8355]}
aktrssraglqfpvgrvhrllrkgnyaervgagapvylaavleyltaeilelagnwerdn
kktriiprhlqlavrndeelnkllgrvtiaqggvlpniqsvllpkk

Timeline for d1zlag_:

• d1zlag_ first appeared in SCOP 1.73, called d1zlag1
  
• d1zlag_ appears in SCOPe 2.02
  
• d1zlag_ appears in SCOPe 2.04
  
• d1zlag_ appears in the current release, SCOPe 2.08