Lineage for d1zjdb1 (1zjd B:3-56)

  1. Root: SCOP 1.75
  2. 888632Class g: Small proteins [56992] (90 folds)
  3. 890511Fold g.8: BPTI-like [57361] (1 superfamily)
    disulfide-rich alpha+beta fold
  4. 890512Superfamily g.8.1: BPTI-like [57362] (3 families) (S)
  5. 890513Family g.8.1.1: Small Kunitz-type inhibitors & BPTI-like toxins [57363] (12 proteins)
  6. 890517Protein Alzheimer's amyloid B-protein precursor, APPI [57370] (1 species)
  7. 890518Species Human (Homo sapiens) [TaxId:9606] [57371] (5 PDB entries)
  8. 890525Domain d1zjdb1: 1zjd B:3-56 [125148]
    Other proteins in same PDB: d1zjda1
    automatically matched to d1aapa_
    mutant

Details for d1zjdb1

PDB Entry: 1zjd (more details), 2.6 Å

PDB Description: crystal structure of the catalytic domain of coagulation factor xi in complex with kunitz protease inhibitor domain of protease nexin ii
PDB Compounds: (B:) Kunitz Protease Inhibitory Domain of Protease Nexin II

SCOP Domain Sequences for d1zjdb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zjdb1 g.8.1.1 (B:3-56) Alzheimer's amyloid B-protein precursor, APPI {Human (Homo sapiens) [TaxId: 9606]}
evcseqaetgpcramisrwyfdvtegkcapffyggcggnrnnfdteeycmavcg

SCOP Domain Coordinates for d1zjdb1:

Click to download the PDB-style file with coordinates for d1zjdb1.
(The format of our PDB-style files is described here.)

Timeline for d1zjdb1: