SCOPe 2.01: Domain d1zjdb_: 1zjd B:

Lineage for d1zjdb_ (1zjd B:)

1. Root: SCOPe 2.01

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.8: BPTI-like [57361] (1 superfamily)
   disulfide-rich alpha+beta fold

4. Superfamily g.8.1: BPTI-like [57362] (4 families)

5. Family g.8.1.1: Small Kunitz-type inhibitors & BPTI-like toxins [57363] (13 proteins)

6. Protein automated matches [190046] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186911] (3 PDB entries)

8. Domain d1zjdb_: 1zjd B: [125148]
   Other proteins in same PDB: d1zjda1
   automated match to d1aapa_

Details for d1zjdb_

PDB Entry: 1zjd, 2.6 Å

PDB Description: crystal structure of the catalytic domain of coagulation factor xi in complex with kunitz protease inhibitor domain of protease nexin ii

PDB Compounds: (B:) Kunitz Protease Inhibitory Domain of Protease Nexin II

SCOPe Domain Sequences for d1zjdb_:

Sequence; same for both SEQRES and ATOM records:

>d1zjdb_ g.8.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evcseqaetgpcramisrwyfdvtegkcapffyggcggnrnnfdteeycmavcgsai

Timeline for d1zjdb_:

• d1zjdb_ first appeared in SCOP 1.73, called d1zjdb1
  
• d1zjdb_ was called d1zjdb1 in SCOP 1.75
  
• d1zjdb_ appears in SCOPe 2.02
  
• d1zjdb_ appears in the current release, SCOPe 2.08