Class g: Small proteins [56992] (90 folds) |
Fold g.8: BPTI-like [57361] (1 superfamily) disulfide-rich alpha+beta fold |
Superfamily g.8.1: BPTI-like [57362] (4 families) |
Family g.8.1.1: Small Kunitz-type inhibitors & BPTI-like toxins [57363] (13 proteins) |
Protein automated matches [190046] (3 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [186911] (3 PDB entries) |
Domain d1zjdb_: 1zjd B: [125148] Other proteins in same PDB: d1zjda1 automated match to d1aapa_ |
PDB Entry: 1zjd (more details), 2.6 Å
SCOPe Domain Sequences for d1zjdb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zjdb_ g.8.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} evcseqaetgpcramisrwyfdvtegkcapffyggcggnrnnfdteeycmavcgsai
Timeline for d1zjdb_: