Class g: Small proteins [56992] (85 folds) |
Fold g.8: BPTI-like [57361] (1 superfamily) disulfide-rich alpha+beta fold |
Superfamily g.8.1: BPTI-like [57362] (2 families) |
Family g.8.1.1: Small Kunitz-type inhibitors & BPTI-like toxins [57363] (12 proteins) |
Protein Alzheimer's amyloid B-protein precursor, APPI [57370] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [57371] (5 PDB entries) |
Domain d1zjdb1: 1zjd B:3-56 [125148] automatically matched to d1aapa_ mutant |
PDB Entry: 1zjd (more details), 2.6 Å
SCOP Domain Sequences for d1zjdb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zjdb1 g.8.1.1 (B:3-56) Alzheimer's amyloid B-protein precursor, APPI {Human (Homo sapiens) [TaxId: 9606]} evcseqaetgpcramisrwyfdvtegkcapffyggcggnrnnfdteeycmavcg
Timeline for d1zjdb1: