SCOP 1.73: Domain d1zjdb1: 1zjd B:3-56

Lineage for d1zjdb1 (1zjd B:3-56)

1. Root: SCOP 1.73

2. Class g: Small proteins [56992] (85 folds)

3. Fold g.8: BPTI-like [57361] (1 superfamily)
   disulfide-rich alpha+beta fold

4. Superfamily g.8.1: BPTI-like [57362] (2 families)

5. Family g.8.1.1: Small Kunitz-type inhibitors & BPTI-like toxins [57363] (12 proteins)

6. Protein Alzheimer's amyloid B-protein precursor, APPI [57370] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57371] (5 PDB entries)

8. Domain d1zjdb1: 1zjd B:3-56 [125148]
   automatically matched to d1aapa_
   mutant

Details for d1zjdb1

PDB Entry: 1zjd, 2.6 Å

PDB Description: crystal structure of the catalytic domain of coagulation factor xi in complex with kunitz protease inhibitor domain of protease nexin ii

PDB Compounds: (B:) Kunitz Protease Inhibitory Domain of Protease Nexin II

SCOP Domain Sequences for d1zjdb1:

Sequence; same for both SEQRES and ATOM records:

>d1zjdb1 g.8.1.1 (B:3-56) Alzheimer's amyloid B-protein precursor, APPI {Human (Homo sapiens) [TaxId: 9606]}
evcseqaetgpcramisrwyfdvtegkcapffyggcggnrnnfdteeycmavcg

Timeline for d1zjdb1:

• d1zjdb1 is new in SCOP 1.73
  
• d1zjdb1 appears in SCOP 1.75
  
• d1zjdb1 appears in the current release, SCOPe 2.08, called d1zjdb_