Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
Protein beta2-microglobulin [88600] (4 species) |
Species Mouse (Mus musculus) [TaxId:10090] [88603] (91 PDB entries) Uniprot P01887 |
Domain d1zhbh1: 1zhb H:1-99 [125089] Other proteins in same PDB: d1zhba1, d1zhba2, d1zhbd1, d1zhbd2, d1zhbg1, d1zhbg2, d1zhbj1, d1zhbj2 automatically matched to d1bz9b_ |
PDB Entry: 1zhb (more details), 2.7 Å
SCOP Domain Sequences for d1zhbh1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zhbh1 b.1.1.2 (H:1-99) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]} iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw sfyilahteftptetdtyacrvkhdsmaepktvywdrdm
Timeline for d1zhbh1: