Lineage for d1zhbk1 (1zhb K:1-99)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 781543Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 783929Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 783930Protein beta2-microglobulin [88600] (4 species)
  7. 784205Species Mouse (Mus musculus) [TaxId:10090] [88603] (91 PDB entries)
    Uniprot P01887
  8. 784299Domain d1zhbk1: 1zhb K:1-99 [125092]
    Other proteins in same PDB: d1zhba1, d1zhba2, d1zhbd1, d1zhbd2, d1zhbg1, d1zhbg2, d1zhbj1, d1zhbj2
    automatically matched to d1bz9b_

Details for d1zhbk1

PDB Entry: 1zhb (more details), 2.7 Å

PDB Description: crystal structure of the murine class i major histocompatibility complex of h-2db, b2-microglobulin, and a 9-residue peptide derived from rat dopamine beta-monooxigenase
PDB Compounds: (K:) Beta-2-microglobulin

SCOP Domain Sequences for d1zhbk1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zhbk1 b.1.1.2 (K:1-99) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]}
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm

SCOP Domain Coordinates for d1zhbk1:

Click to download the PDB-style file with coordinates for d1zhbk1.
(The format of our PDB-style files is described here.)

Timeline for d1zhbk1: