Lineage for d1zhbg2 (1zhb G:3-180)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 856282Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 856283Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 856284Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins)
  6. 856331Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (27 species)
  7. 856608Species Mouse (Mus musculus), H-2DD [TaxId:10090] [54485] (21 PDB entries)
  8. 856632Domain d1zhbg2: 1zhb G:3-180 [125088]
    Other proteins in same PDB: d1zhba1, d1zhbb1, d1zhbd1, d1zhbe1, d1zhbg1, d1zhbh1, d1zhbj1, d1zhbk1
    automatically matched to d1ddha2

Details for d1zhbg2

PDB Entry: 1zhb (more details), 2.7 Å

PDB Description: crystal structure of the murine class i major histocompatibility complex of h-2db, b2-microglobulin, and a 9-residue peptide derived from rat dopamine beta-monooxigenase
PDB Compounds: (G:) H-2 class I histocompatibility antigen, D-B alpha chain

SCOP Domain Sequences for d1zhbg2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zhbg2 d.19.1.1 (G:3-180) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2DD [TaxId: 10090]}
hsmryfetavsrpgleepryisvgyvdnkefvrfdsdaenpryeprapwmeqegpeywer
etqkakgqeqwfrvslrnllgyynqsaggshtlqqmsgcdlgsdwrllrgylqfayegrd
yialnedlktwtaadmaaqitrrkweqsgaaehykaylegecvewlhrylkngnatll

SCOP Domain Coordinates for d1zhbg2:

Click to download the PDB-style file with coordinates for d1zhbg2.
(The format of our PDB-style files is described here.)

Timeline for d1zhbg2: