Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.58: Ferredoxin-like [54861] (55 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.7: RNA-binding domain, RBD [54928] (4 families) |
Family d.58.7.1: Canonical RBD [54929] (67 proteins) |
Protein Lupus LA protein [89940] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [89941] (4 PDB entries) |
Domain d1zh5a2: 1zh5 A:105-189 [125074] Other proteins in same PDB: d1zh5a1, d1zh5b1 automatically matched to d1s79a_ complexed with so4 |
PDB Entry: 1zh5 (more details), 1.85 Å
SCOP Domain Sequences for d1zh5a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} kndvknrsvyikgfptdatlddikewledkgqvlniqmrrtlhkafkgsifvvfdsiesa kkfvetpgqkyketdllilfkddyf
Timeline for d1zh5a2: