Class a: All alpha proteins [46456] (258 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (68 families) contains a small beta-sheet (wing) |
Family a.4.5.46: La domain [101051] (2 proteins) Pfam PF05383; RNA-binding domain |
Protein Lupus La autoantigen N-terminal domain [101052] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [101053] (3 PDB entries) |
Domain d1zh5b1: 1zh5 B:6-103 [125075] Other proteins in same PDB: d1zh5a2, d1zh5b2 automatically matched to d1s7aa_ complexed with so4 |
PDB Entry: 1zh5 (more details), 1.85 Å
SCOP Domain Sequences for d1zh5b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zh5b1 a.4.5.46 (B:6-103) Lupus La autoantigen N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} dnekmaaleakichqieyyfgdfnlprdkflkeqikldegwvpleimikfnrlnrlttdf nvivealskskaelmeisedktkirrspskplpevtde
Timeline for d1zh5b1: