Lineage for d1zh5b1 (1zh5 B:6-103)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 634286Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 634918Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (68 families) (S)
    contains a small beta-sheet (wing)
  5. 635741Family a.4.5.46: La domain [101051] (2 proteins)
    Pfam PF05383; RNA-binding domain
  6. 635745Protein Lupus La autoantigen N-terminal domain [101052] (2 species)
  7. 635746Species Human (Homo sapiens) [TaxId:9606] [101053] (3 PDB entries)
  8. 635748Domain d1zh5b1: 1zh5 B:6-103 [125075]
    Other proteins in same PDB: d1zh5a2, d1zh5b2
    automatically matched to d1s7aa_
    complexed with so4

Details for d1zh5b1

PDB Entry: 1zh5 (more details), 1.85 Å

PDB Description: Structural basis for recognition of UUUOH 3'-terminii of nascent RNA pol III transcripts by La autoantigen
PDB Compounds: (B:) Lupus La protein

SCOP Domain Sequences for d1zh5b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zh5b1 a.4.5.46 (B:6-103) Lupus La autoantigen N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
dnekmaaleakichqieyyfgdfnlprdkflkeqikldegwvpleimikfnrlnrlttdf
nvivealskskaelmeisedktkirrspskplpevtde

SCOP Domain Coordinates for d1zh5b1:

Click to download the PDB-style file with coordinates for d1zh5b1.
(The format of our PDB-style files is described here.)

Timeline for d1zh5b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1zh5b2