SCOPe 2.08: Domain d1zg8c_: 1zg8 C:

Lineage for d1zg8c_ (1zg8 C:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.5: Zn-dependent exopeptidases [53187] (10 families)
   core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest

5. Family c.56.5.1: Pancreatic carboxypeptidases [53188] (5 proteins)

6. Protein automated matches [190397] (2 species)
   not a true protein

7. Species Pig (Sus scrofa) [TaxId:9823] [187266] (20 PDB entries)

8. Domain d1zg8c_: 1zg8 C: [125019]
   automated match to d1z5ra1
   complexed with l98, zn

Details for d1zg8c_

PDB Entry: 1zg8, 2 Å

PDB Description: Crystal Structure of (R)-2-(3-{[amino(imino)methyl]amino}phenyl)-3-sulfanylpropanoic acid Bound to Activated Porcine Pancreatic Carboxypeptidase B

PDB Compounds: (C:) Procarboxypeptidase B

SCOPe Domain Sequences for d1zg8c_:

Sequence; same for both SEQRES and ATOM records:

>d1zg8c_ c.56.5.1 (C:) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
ghsyekynnwetieawtkqvtsenpdlisrtaigttflgnniyllkvgkpgpnkpaifmd
cgfharewishafcqwfvreavltygyeshmteflnkldfyvlpvlnidgyiytwtknrm
wrktrstnagttcigtdpnrnfdagwcttgastdpcdetycgsaaeseketkaladfirn
nlssikayltihsysqmilypysydyklpennaelnnlakaavkelatlygtkytygpga
ttiypaaggsddwaydqgikysftfelrdkgrygfilpesqiqatceetmlaikyvtnyv
lghl

Timeline for d1zg8c_:

• d1zg8c_ first appeared in SCOP 1.73, called d1zg8c1
  
• d1zg8c_ appears in SCOPe 2.07