SCOPe 2.07: Domain d1zg1b1: 1zg1 B:151-216

Lineage for d1zg1b1 (1zg1 B:151-216)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.6: C-terminal effector domain of the bipartite response regulators [46894] (4 families)
   binds to DNA and RNA polymerase; the N-terminal, receiver domain belongs to the CheY family

5. Family a.4.6.2: GerE-like (LuxR/UhpA family of transcriptional regulators) [46900] (5 proteins)
   contains additional, fourth helix in the C-terminal extension

6. Protein Nitrate/nitrite response regulator (NarL) [46901] (1 species)

7. Species Escherichia coli [TaxId:562] [46902] (5 PDB entries)

8. Domain d1zg1b1: 1zg1 B:151-216 [125006]
   automatically matched to d1a04a1
   protein/DNA complex; complexed with so4

Details for d1zg1b1

PDB Entry: 1zg1, 2.3 Å

PDB Description: NarL complexed to nirB promoter non-palindromic tail-to-tail DNA site

PDB Compounds: (B:) nitrate/nitrite response regulator protein narl

SCOPe Domain Sequences for d1zg1b1:

Sequence; same for both SEQRES and ATOM records:

>d1zg1b1 a.4.6.2 (B:151-216) Nitrate/nitrite response regulator (NarL) {Escherichia coli [TaxId: 562]}
rdvnqltprerdilkliaqglpnkmiarrlditestvkvhvkhmlkkmklksrveaavwv
hqerif

Timeline for d1zg1b1:

• d1zg1b1 first appeared in SCOP 1.73
  
• d1zg1b1 appears in SCOPe 2.06
  
• d1zg1b1 appears in the current release, SCOPe 2.08