Lineage for d1zdxa1 (1zdx A:25-125)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2434284Fold b.167: FimD N-terminal domain-like [141728] (1 superfamily)
    pseudo barrel, capped by an alpha-helix; some topological similarity to the PRC-barrel domain (50346) and the N-terminal domain of Glutamine synthetase (54368)
  4. 2434285Superfamily b.167.1: FimD N-terminal domain-like [141729] (2 families) (S)
    automatically mapped to Pfam PF13954
  5. 2434286Family b.167.1.1: Usher N-domain [141730] (1 protein)
    N-terminal part of Pfam PF00577
  6. 2434287Protein Outer membrane usher protein FimD [141731] (1 species)
  7. 2434288Species Escherichia coli [TaxId:562] [141732] (4 PDB entries)
    Uniprot P30130 46-170! Uniprot P30130 70-170! Uniprot P30130 70-184
  8. 2434291Domain d1zdxa1: 1zdx A:25-125 [124960]

Details for d1zdxa1

PDB Entry: 1zdx (more details)

PDB Description: solution structure of the type 1 pilus assembly platform fimd(25-125)
PDB Compounds: (A:) Outer membrane usher protein fimD

SCOPe Domain Sequences for d1zdxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zdxa1 b.167.1.1 (A:25-125) Outer membrane usher protein FimD {Escherichia coli [TaxId: 562]}
gqelppgtyrvdiylnngymatrdvtfntgdseqgivpcltraqlasmglntasvagmnl
laddacvplttmvqdatahldvgqqrlnltipqafmsnrar

SCOPe Domain Coordinates for d1zdxa1:

Click to download the PDB-style file with coordinates for d1zdxa1.
(The format of our PDB-style files is described here.)

Timeline for d1zdxa1: