Class b: All beta proteins [48724] (180 folds) |
Fold b.167: FimD N-terminal domain-like [141728] (1 superfamily) pseudo barrel, capped by an alpha-helix; some topological similarity to the PRC-barrel domain (50346) and the N-terminal domain of Glutamine synthetase (54368) |
Superfamily b.167.1: FimD N-terminal domain-like [141729] (2 families) automatically mapped to Pfam PF13954 |
Family b.167.1.1: Usher N-domain [141730] (1 protein) N-terminal part of Pfam PF00577 |
Protein Outer membrane usher protein FimD [141731] (1 species) |
Species Escherichia coli [TaxId:562] [141732] (5 PDB entries) Uniprot P30130 46-170! Uniprot P30130 70-170! Uniprot P30130 70-184 |
Domain d1zdxa1: 1zdx A:25-125 [124960] |
PDB Entry: 1zdx (more details)
SCOPe Domain Sequences for d1zdxa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zdxa1 b.167.1.1 (A:25-125) Outer membrane usher protein FimD {Escherichia coli [TaxId: 562]} gqelppgtyrvdiylnngymatrdvtfntgdseqgivpcltraqlasmglntasvagmnl laddacvplttmvqdatahldvgqqrlnltipqafmsnrar
Timeline for d1zdxa1: