Lineage for d1zdqb1 (1zdq B:4-161)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2366402Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2366403Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2367979Family b.6.1.0: automated matches [191502] (1 protein)
    not a true family
  6. 2367980Protein automated matches [190824] (23 species)
    not a true protein
  7. 2367999Species Alcaligenes faecalis [TaxId:511] [226762] (16 PDB entries)
  8. 2368034Domain d1zdqb1: 1zdq B:4-161 [124948]
    automated match to d3h4fa1
    complexed with cu, msm

Details for d1zdqb1

PDB Entry: 1zdq (more details), 1.8 Å

PDB Description: Crystal Structure of Met150Gly AfNiR with Methylsulfanyl Methane Bound
PDB Compounds: (B:) Copper-containing nitrite reductase

SCOPe Domain Sequences for d1zdqb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zdqb1 b.6.1.0 (B:4-161) automated matches {Alcaligenes faecalis [TaxId: 511]}
ataaeiaalprqkvelvdppfvhahsqvaeggpkvveftmvieekkividdagtevhama
fngtvpgplmvvhqddyleltlinpetntlmhnidfhaatgalgggglteinpgektilr
fkatkpgvfvyhcappgmvpwhvvsggngaimvlpreg

SCOPe Domain Coordinates for d1zdqb1:

Click to download the PDB-style file with coordinates for d1zdqb1.
(The format of our PDB-style files is described here.)

Timeline for d1zdqb1: