![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
![]() | Superfamily b.6.1: Cupredoxins [49503] (8 families) ![]() contains copper-binding site |
![]() | Family b.6.1.0: automated matches [191502] (1 protein) not a true family |
![]() | Protein automated matches [190824] (31 species) not a true protein |
![]() | Species Alcaligenes faecalis [TaxId:511] [226762] (16 PDB entries) |
![]() | Domain d1zdqa1: 1zdq A:5-161 [124946] automated match to d3h4fa1 complexed with cu, msm |
PDB Entry: 1zdq (more details), 1.8 Å
SCOPe Domain Sequences for d1zdqa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zdqa1 b.6.1.0 (A:5-161) automated matches {Alcaligenes faecalis [TaxId: 511]} taaeiaalprqkvelvdppfvhahsqvaeggpkvveftmvieekkividdagtevhamaf ngtvpgplmvvhqddyleltlinpetntlmhnidfhaatgalgggglteinpgektilrf katkpgvfvyhcappgmvpwhvvsggngaimvlpreg
Timeline for d1zdqa1:
![]() Domains from other chains: (mouse over for more information) d1zdqb1, d1zdqb2, d1zdqc1, d1zdqc2 |