Lineage for d1zdqc1 (1zdq C:4-161)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2770398Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2770399Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2772201Family b.6.1.0: automated matches [191502] (1 protein)
    not a true family
  6. 2772202Protein automated matches [190824] (31 species)
    not a true protein
  7. 2772230Species Alcaligenes faecalis [TaxId:511] [226762] (16 PDB entries)
  8. 2772267Domain d1zdqc1: 1zdq C:4-161 [124950]
    automated match to d3h4fa1
    complexed with cu, msm

Details for d1zdqc1

PDB Entry: 1zdq (more details), 1.8 Å

PDB Description: crystal structure of met150gly afnir with methylsulfanyl methane bound
PDB Compounds: (C:) Copper-containing nitrite reductase

SCOPe Domain Sequences for d1zdqc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zdqc1 b.6.1.0 (C:4-161) automated matches {Alcaligenes faecalis [TaxId: 511]}
ataaeiaalprqkvelvdppfvhahsqvaeggpkvveftmvieekkividdagtevhama
fngtvpgplmvvhqddyleltlinpetntlmhnidfhaatgalgggglteinpgektilr
fkatkpgvfvyhcappgmvpwhvvsggngaimvlpreg

SCOPe Domain Coordinates for d1zdqc1:

Click to download the PDB-style file with coordinates for d1zdqc1.
(The format of our PDB-style files is described here.)

Timeline for d1zdqc1: