SCOPe 2.02: Domain d1zcaa2: 1zca A:54-82,A:205-371

Lineage for d1zcaa2 (1zca A:54-82,A:205-371)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (79 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein Transducin (alpha subunit) [52623] (4 species)
   common fold is interrupted with an all-alpha domain

7. Species Mouse (Mus musculus) [TaxId:10090] [142225] (4 PDB entries)
   Uniprot P21279 38-66,184-354! Uniprot P27600 53-81,204-370! Uniprot P27601 47-75,202-372

8. Domain d1zcaa2: 1zca A:54-82,A:205-371 [124898]
   Other proteins in same PDB: d1zcaa1, d1zcab1
   G alpha i/12
   complexed with alf, gdp, mg

Details for d1zcaa2

PDB Entry: 1zca, 2.9 Å

PDB Description: crystal structure of g alpha 12 in complex with gdp, mg2+ and alf4-

PDB Compounds: (A:) G alpha i/12

SCOPe Domain Sequences for d1zcaa2:

Sequence; same for both SEQRES and ATOM records:

>d1zcaa2 c.37.1.8 (A:54-82,A:205-371) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]}
rlvkilllgagesgkstflkqmriihgreXatkgivehdfvikkipfkmvdvggqrsqrq
kwfqcfdgitsilfmvssseydqvlmedrrtnrlvesmnifetivnnklffnvsiilfln
kmdllvekvksvsikkhfpdfkgdphrledvqrylvqcfdrkrrnrskplfhhfttaidt
enirfvfhavkdtilqe

Timeline for d1zcaa2:

• d1zcaa2 first appeared in SCOP 1.73
  
• d1zcaa2 appears in SCOPe 2.01
  
• d1zcaa2 appears in SCOPe 2.03
  
• d1zcaa2 appears in the current release, SCOPe 2.08