![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.8: G proteins [52592] (81 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
![]() | Protein Transducin (alpha subunit) [52623] (4 species) common fold is interrupted with an all-alpha domain |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [142225] (5 PDB entries) Uniprot P21279 38-66,184-354! Uniprot P27600 53-81,204-370! Uniprot P27601 47-75,202-372 |
![]() | Domain d1zcaa2: 1zca A:54-82,A:205-371 [124898] Other proteins in same PDB: d1zcaa1, d1zcab1 G alpha i/12 complexed with alf, gdp, mg has additional subdomain(s) that are not in the common domain |
PDB Entry: 1zca (more details), 2.9 Å
SCOPe Domain Sequences for d1zcaa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zcaa2 c.37.1.8 (A:54-82,A:205-371) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} rlvkilllgagesgkstflkqmriihgreXatkgivehdfvikkipfkmvdvggqrsqrq kwfqcfdgitsilfmvssseydqvlmedrrtnrlvesmnifetivnnklffnvsiilfln kmdllvekvksvsikkhfpdfkgdphrledvqrylvqcfdrkrrnrskplfhhfttaidt enirfvfhavkdtilqe
Timeline for d1zcaa2: