Lineage for d1zc8y2 (1zc8 Y:313-405)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1317759Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 1317760Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (1 family) (S)
    probably related to the second domain and its superfamiy by a circular permutation
  5. 1317761Family b.44.1.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50466] (6 proteins)
  6. 1317789Protein Elongation factor Tu (EF-Tu) [50467] (4 species)
  7. 1317821Species Thermus thermophilus [TaxId:274] [50470] (6 PDB entries)
  8. 1317831Domain d1zc8y2: 1zc8 Y:313-405 [124894]
    Other proteins in same PDB: d1zc8k1, d1zc8y1, d1zc8y3
    automatically matched to d1aipa2
    protein/RNA complex

Details for d1zc8y2

PDB Entry: 1zc8 (more details), 13 Å

PDB Description: Coordinates of tmRNA, SmpB, EF-Tu and h44 fitted into Cryo-EM map of the 70S ribosome and tmRNA complex
PDB Compounds: (Y:) elongation factor tu

SCOPe Domain Sequences for d1zc8y2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zc8y2 b.44.1.1 (Y:313-405) Elongation factor Tu (EF-Tu) {Thermus thermophilus [TaxId: 274]}
htkfeasvyilkkeeggrhtgfftgyrpqfyfrttdvtgvvrlpqgvemvmpgdnvtftv
elikpvaleeglrfaireggrtvgagvvtkile

SCOPe Domain Coordinates for d1zc8y2:

Click to download the PDB-style file with coordinates for d1zc8y2.
(The format of our PDB-style files is described here.)

Timeline for d1zc8y2:

View in 3D
Domains from other chains:
(mouse over for more information)
d1zc8k1