Lineage for d1zc8y2 (1zc8 Y:313-405)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 669876Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 669877Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (1 family) (S)
    probably related to the second domain and its superfamiy by a circular permutation
  5. 669878Family b.44.1.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50466] (6 proteins)
  6. 669906Protein Elongation factor Tu (EF-Tu) [50467] (4 species)
  7. 669935Species Thermus thermophilus [TaxId:274] [50470] (7 PDB entries)
  8. 669948Domain d1zc8y2: 1zc8 Y:313-405 [124894]
    Other proteins in same PDB: d1zc8k1, d1zc8y1, d1zc8y3
    automatically matched to d1aipa2
    complexed with du

Details for d1zc8y2

PDB Entry: 1zc8 (more details)

PDB Description: Coordinates of tmRNA, SmpB, EF-Tu and h44 fitted into Cryo-EM map of the 70S ribosome and tmRNA complex
PDB Compounds: (Y:) elongation factor tu

SCOP Domain Sequences for d1zc8y2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zc8y2 b.44.1.1 (Y:313-405) Elongation factor Tu (EF-Tu) {Thermus thermophilus [TaxId: 274]}
htkfeasvyilkkeeggrhtgfftgyrpqfyfrttdvtgvvrlpqgvemvmpgdnvtftv
elikpvaleeglrfaireggrtvgagvvtkile

SCOP Domain Coordinates for d1zc8y2:

Click to download the PDB-style file with coordinates for d1zc8y2.
(The format of our PDB-style files is described here.)

Timeline for d1zc8y2:

View in 3D
Domains from other chains:
(mouse over for more information)
d1zc8k1