Lineage for d1zc8y1 (1zc8 Y:213-312)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1317091Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 1317134Superfamily b.43.3: Translation proteins [50447] (7 families) (S)
  5. 1317135Family b.43.3.1: Elongation factors [50448] (10 proteins)
  6. 1317224Protein Elongation factor Tu (EF-Tu), domain 2 [50449] (4 species)
    N-terminal domain is related to G proteins; C-terminal domain is (6,10) barrel of circularly permuted topology
  7. 1317256Species Thermus thermophilus [TaxId:274] [50452] (6 PDB entries)
  8. 1317266Domain d1zc8y1: 1zc8 Y:213-312 [124893]
    Other proteins in same PDB: d1zc8k1, d1zc8y2, d1zc8y3
    automatically matched to d1aipa1
    protein/RNA complex

Details for d1zc8y1

PDB Entry: 1zc8 (more details), 13 Å

PDB Description: Coordinates of tmRNA, SmpB, EF-Tu and h44 fitted into Cryo-EM map of the 70S ribosome and tmRNA complex
PDB Compounds: (Y:) elongation factor tu

SCOPe Domain Sequences for d1zc8y1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zc8y1 b.43.3.1 (Y:213-312) Elongation factor Tu (EF-Tu), domain 2 {Thermus thermophilus [TaxId: 274]}
pvrdvdkpflmpvedvftitgrgtvatgriergkvkvgdeveivglapetrktvvtgvem
hrktlqegiagdnvglllrgvsreevergqvlakpgsitp

SCOPe Domain Coordinates for d1zc8y1:

Click to download the PDB-style file with coordinates for d1zc8y1.
(The format of our PDB-style files is described here.)

Timeline for d1zc8y1:

View in 3D
Domains from other chains:
(mouse over for more information)
d1zc8k1