Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) division into families based on beta-sheet topologies |
Family c.37.1.8: G proteins [52592] (80 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
Protein Ras-related protein RalA [89662] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [89663] (5 PDB entries) |
Domain d1zc4a_: 1zc4 A: [124884] Other proteins in same PDB: d1zc4b1, d1zc4d_ automated match to d1uada_ complexed with gnp, mg |
PDB Entry: 1zc4 (more details), 2.5 Å
SCOPe Domain Sequences for d1zc4a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zc4a_ c.37.1.8 (A:) Ras-related protein RalA {Human (Homo sapiens) [TaxId: 9606]} slalhkvimvgsggvgksaltlqfmydefvedyeptkadsyrkkvvldgeevqidildta gledyaairdnyfrsgegflcvfsitemesfaatadfreqilrvkedenvpfllvgnksd ledkrqvsveeaknraeqwnvnyvetsaktranvdkvffdlmreirarkmeds
Timeline for d1zc4a_: