SCOPe 2.07: Domain d1zc4c_: 1zc4 C:

Lineage for d1zc4c_ (1zc4 C:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (80 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein Ras-related protein RalA [89662] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [89663] (5 PDB entries)

8. Domain d1zc4c_: 1zc4 C: [124886]
   Other proteins in same PDB: d1zc4b1, d1zc4d_
   automated match to d1uada_
   complexed with gnp, mg

Details for d1zc4c_

PDB Entry: 1zc4, 2.5 Å

PDB Description: crystal structure of the ral-binding domain of exo84 in complex with the active rala

PDB Compounds: (C:) Ras-related protein Ral-A

SCOPe Domain Sequences for d1zc4c_:

Sequence; same for both SEQRES and ATOM records:

>d1zc4c_ c.37.1.8 (C:) Ras-related protein RalA {Human (Homo sapiens) [TaxId: 9606]}
slalhkvimvgsggvgksaltlqfmydefvedyeptkadsyrkkvvldgeevqidildta
gledyaairdnyfrsgegflcvfsitemesfaatadfreqilrvkedenvpfllvgnksd
ledkrqvsveeaknraeqwnvnyvetsaktranvdkvffdlmreirarkmeds

Timeline for d1zc4c_:

• d1zc4c_ first appeared in SCOP 1.73, called d1zc4c1
  
• d1zc4c_ appears in SCOPe 2.06
  
• d1zc4c_ appears in the current release, SCOPe 2.08