SCOPe 2.01: Domain d1zbob_: 1zbo B:

Lineage for d1zbob_ (1zbo B:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.122: PUA domain-like [88696] (1 superfamily)
   pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other

4. Superfamily b.122.1: PUA domain-like [88697] (14 families)

5. Family b.122.1.10: LON domain-like [141723] (3 proteins)
   Pfam PF02190

6. Protein automated matches [190853] (1 species)
   not a true protein

7. Species Bordetella parapertussis [TaxId:257311] [188178] (1 PDB entry)

8. Domain d1zbob_: 1zbo B: [124860]
   Other proteins in same PDB: d1zboa1
   automated match to d1zboa1

Details for d1zbob_

PDB Entry: 1zbo, 2.6 Å

PDB Description: x-ray crystal structure of protein bpp1347 from bordetella parapertussis. northeast structural genomics consortium target bor27.

PDB Compounds: (B:) hypothetical protein BPP1347

SCOPe Domain Sequences for d1zbob_:

Sequence; same for both SEQRES and ATOM records:

>d1zbob_ b.122.1.10 (B:) automated matches {Bordetella parapertussis [TaxId: 257311]}
aeiplfplsnalfpagvlrlrvfeiryldmvrrciadgsefgvvvleqgtevrrpdgrev
laragtmaridhweapmpallelactgtgrfrlhactqgkyglwtgqaepvpddaplevp
pelarsasalgrliarlqregvpphimpmaapfrlddcgwvadrwaemlslppadkarll
llppldrlreidavlaadgh

Timeline for d1zbob_:

• d1zbob_ first appeared in SCOP 1.73, called d1zbob1
  
• d1zbob_ was called d1zbob1 in SCOP 1.75
  
• d1zbob_ appears in SCOPe 2.02
  
• d1zbob_ appears in the current release, SCOPe 2.08