![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.122: PUA domain-like [88696] (1 superfamily) pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other |
![]() | Superfamily b.122.1: PUA domain-like [88697] (15 families) ![]() |
![]() | Family b.122.1.10: LON domain-like [141723] (3 proteins) Pfam PF02190 |
![]() | Protein automated matches [190853] (1 species) not a true protein |
![]() | Species Bordetella parapertussis [TaxId:257311] [188178] (1 PDB entry) |
![]() | Domain d1zbob_: 1zbo B: [124860] Other proteins in same PDB: d1zboa1 automated match to d1zboa1 |
PDB Entry: 1zbo (more details), 2.6 Å
SCOPe Domain Sequences for d1zbob_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zbob_ b.122.1.10 (B:) automated matches {Bordetella parapertussis [TaxId: 257311]} aeiplfplsnalfpagvlrlrvfeiryldmvrrciadgsefgvvvleqgtevrrpdgrev laragtmaridhweapmpallelactgtgrfrlhactqgkyglwtgqaepvpddaplevp pelarsasalgrliarlqregvpphimpmaapfrlddcgwvadrwaemlslppadkarll llppldrlreidavlaadgh
Timeline for d1zbob_: