Lineage for d1zbob_ (1zbo B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2823864Fold b.122: PUA domain-like [88696] (1 superfamily)
    pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other
  4. 2823865Superfamily b.122.1: PUA domain-like [88697] (15 families) (S)
  5. 2824048Family b.122.1.10: LON domain-like [141723] (3 proteins)
    Pfam PF02190
  6. 2824062Protein automated matches [190853] (1 species)
    not a true protein
  7. 2824063Species Bordetella parapertussis [TaxId:257311] [188178] (1 PDB entry)
  8. 2824064Domain d1zbob_: 1zbo B: [124860]
    Other proteins in same PDB: d1zboa1
    automated match to d1zboa1

Details for d1zbob_

PDB Entry: 1zbo (more details), 2.6 Å

PDB Description: x-ray crystal structure of protein bpp1347 from bordetella parapertussis. northeast structural genomics consortium target bor27.
PDB Compounds: (B:) hypothetical protein BPP1347

SCOPe Domain Sequences for d1zbob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zbob_ b.122.1.10 (B:) automated matches {Bordetella parapertussis [TaxId: 257311]}
aeiplfplsnalfpagvlrlrvfeiryldmvrrciadgsefgvvvleqgtevrrpdgrev
laragtmaridhweapmpallelactgtgrfrlhactqgkyglwtgqaepvpddaplevp
pelarsasalgrliarlqregvpphimpmaapfrlddcgwvadrwaemlslppadkarll
llppldrlreidavlaadgh

SCOPe Domain Coordinates for d1zbob_:

Click to download the PDB-style file with coordinates for d1zbob_.
(The format of our PDB-style files is described here.)

Timeline for d1zbob_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1zboa1