SCOPe 2.07: Domain d1zalb_: 1zal B:

Lineage for d1zalb_ (1zal B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.10: Aldolase [51569] (9 families)
   Common fold covers whole protein structure

5. Family c.1.10.1: Class I aldolase [51570] (13 proteins)
   the catalytic lysine forms schiff-base intermediate with substrate
   possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels

6. Protein Fructose-1,6-bisphosphate aldolase [51576] (11 species)

7. Species Rabbit (Oryctolagus cuniculus), muscle isozyme [TaxId:9986] [51580] (33 PDB entries)

8. Domain d1zalb_: 1zal B: [124837]
   automated match to d1adoa_
   complexed with po4

Details for d1zalb_

PDB Entry: 1zal, 1.89 Å

PDB Description: fructose-1,6-bisphosphate aldolase from rabbit muscle in complex with partially disordered tagatose-1,6-bisphosphate, a weak competitive inhibitor

PDB Compounds: (B:) Fructose-bisphosphate aldolase A

SCOPe Domain Sequences for d1zalb_:

Sequence; same for both SEQRES and ATOM records:

>d1zalb_ c.1.10.1 (B:) Fructose-1,6-bisphosphate aldolase {Rabbit (Oryctolagus cuniculus), muscle isozyme [TaxId: 9986]}
phshpaltpeqkkelsdiahrivapgkgilaadestgsiakrlqsigtenteenrrfyrq
llltaddrvnpciggvilfhetlyqkaddgrpfpqvikskggvvgikvdkgvvplagtng
etttqgldglsercaqykkdgadfakwrcvlkigehtpsalaimenanvlaryasicqqn
givpivepeilpdgdhdlkrcqyvtekvlaavykalsdhhiylegtllkpnmvtpghact
qkysheeiamatvtalrrtvppavtgvtflsggqseeeasinlnainkcpllkpwaltfs
ygralqasalkawggkkenlkaaqeeyvkralanslacqgkytpsgqagaaaseslfisn
hay

Timeline for d1zalb_:

• d1zalb_ first appeared in SCOP 1.73, called d1zalb1
  
• d1zalb_ appears in SCOPe 2.06
  
• d1zalb_ appears in the current release, SCOPe 2.08